SAB2103688

Anti-ZFP90 antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-NK10, Anti-ZNF756
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 73 kDa
• species reactivity: mouse, rat, bovine, horse, rabbit, dog, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NM_133458
• UniProt accession no.: Q8TF47
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ZFP90(146198)

Description

Immunogen

Synthetic peptide directed towards the middle region of human ZFP90

Biochem/physiol Actions

ZFP90 may function as a repressor or silencer protein, and most likely exerts its repressing activity upon zinc-dependent binding to DNA. It may be involved in proper spermatogenesis by repressing the expression of genes unnecessary or incompatible with the maintenance of a haploid cell state.

Sequence

Synthetic peptide located within the following region: SSLVQHQRIHTGEKPYRCNLCGRSFRHGTSLTQHEVTHSGEKPFQCKECG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable