Skip to Content
Merck
All Photos(1)

Key Documents

SAB2100357

Sigma-Aldrich

Anti-CCK antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Cholecystokinin, Anti-MGC117187

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₩824,891

₩824,891


Estimated to ship onMay 30, 2025Details

New, lower price on this item!


Select a Size

Change View
100 μL
₩824,891

About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

₩824,891


Estimated to ship onMay 30, 2025Details

New, lower price on this item!

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

13 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CCK(885)

General description

CCK codes for cholecystokinin. It is a brain/gut peptide. This gene is located on human chromosome 3p22.

Immunogen

Synthetic peptide directed towards the middle region of human CCK

Application

Anti-CCK antibody produced in rabbit has been used in staining.

Biochem/physiol Actions

Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.

Sequence

Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

3p22. 1p21. 31 microdeletion identifies CCK as Asperger syndrome candidate gene and shows the way for therapeutic strategies in chromosome imbalances
Iourov IY, et al.
Molecular Cytogenetics, 8(1), 82-82 (2015)
Role of CCK/gastrin receptors in gastrointestinal/metabolic diseases and results of human studies using gastrin/CCK receptor agonists/antagonists in these diseases
Berna MJ, et al.
Current Topics in Medicinal Chemistry, 7(12), 1211-1211 (2007)
Alteration of Interneuron Immunoreactivity and Autophagic Activity in Rat Hippocampus after Single High-Dose Whole-Brain Irradiation
Ouyang YB, et al.
Cureus, 9(6) (2017)
Mechanism of action of cholecystokinin: a not atypical brain-gut peptide
Williams JA
Nihon Naibunpi Gakkai Zasshi, 61(5), 533-540 (1985)
Christina Georgiou et al.
Communications biology, 5(1), 352-352 (2022-04-15)
Structural synaptic plasticity may underlie experience and learning-dependent changes in cortical circuits. In contrast to excitatory pyramidal neurons, insight into the structural plasticity of inhibitory neurons remains limited. Interneurons are divided into various subclasses, each with specialized functions in cortical

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service