Skip to Content
Merck
All Photos(7)

Documents

HPA005546

Sigma-Aldrich

Anti-DLGAP5 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-DLG7 antibody produced in rabbit, Anti-Discs large homolog 7 antibody produced in rabbit, Anti-HURP antibody produced in rabbit, Anti-Hepatoma up-regulated protein antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

ASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTNVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DLGAP5(9787)

General description

DLGAP5 (discs, large (Drosophila) homolog-associated protein 5) is a microtubule associated protein. It is also a gene regulated by cell cycle. During mitosis, it localizes to spindle poles. In humans, DLGAP5 gene is mapped to chromosome 14q22-23, and consists of 19 exons. This protein consists of a putative nuclear export signal (NES), which is rich in leucine, a coiled-coil domain, two destruction boxes (D-box), and a KEN box. It also consists of GKAP homology domain 1 (GH1), which is made up of ~100 amino acids. DLGAP5 protein is highly expressed in normal tissues with high level of proliferation, such as testis, thymus, fetal liver, and colon.

Immunogen

Discs large homolog 7 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

DLGAP5 (discs, large (Drosophila) homolog-associated protein 5) is a substrate for Aurora A, which regulates its accessibility and binding to mitotic spindle. It also facilitates the assembly of mitotic spindle and helps in chromosome segregation. During mitosis, it mediates the inter-kinetochore tension. Aberrant increase in DLGAP5 expression results in abnormal spindle function, leading to aneuploidy and tumorigenesis. It has potential as a marker for early detection of bladder cancer and bilharzial bladder cancer. Overexpression of DLGAP5 and its truncated form KIAA0008 is linked with human colon cancer, breast cancer, hepatocellular carcinoma, and transitional cell carcinoma. It has been suggested that it acts as an oncogene, as it suppresses p53, which is a tumor suppressor gene. DLGAP5 gene has potential to determine the prognosis of high-risk prostate cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70349

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Thibault Courthéoux et al.
Journal of cell science, 132(10) (2019-04-28)
During mitosis, the cell sequentially constructs two microtubule-based spindles to ensure faithful segregation of chromosomes. A bipolar spindle first pulls apart the sister chromatids, then a central spindle further separates them away. Although the assembly of the first spindle is
Kay Hewit et al.
Cell death & disease, 9(11), 1069-1069 (2018-10-21)
Based on a molecular classification of prostate cancer using gene expression pathway signatures, we derived a set of 48 genes in critical pathways that significantly predicts clinical outcome in all tested patient cohorts. We tested these genes in a functional
Sanaa Eissa et al.
Medical oncology (Northwood, London, England), 31(2), 804-804 (2014-01-01)
This study was carried out to assess the efficacy of urinary hepatoma up-regulated protein (HURP) RNA in bladder cancer diagnosis and its relation to bilharziasis. Voided urine samples and blood were collected from 344 consecutive participants: 211 patients diagnosed with
Christian R Gomez et al.
PloS one, 8(12), e82833-e82833 (2013-12-19)
Hypoxia has been associated with malignant progression, metastasis and resistance to therapy. Hence, we studied expression of hypoxia-regulated genes in 100 prostate cancer (CaP) bulk tissues and 71 adjacent benign tissues. We found 24 transcripts significantly overexpressed (p ≤ 0.02).
Ann-Ping Tsou et al.
Oncogene, 22(2), 298-307 (2003-01-16)
An analytic strategy was followed to identify putative regulatory genes during the development of human hepatocellular carcinoma (HCC). This strategy employed a bioinformatics analysis that used a database search to identify genes, which are differentially expressed in human HCC and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service