Skip to Content
Merck
All Photos(2)

Key Documents

HPA000325

Sigma-Aldrich

Anti-ARMCX3 antibody produced in rabbit

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-ALEX3, Anti-GASP6

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₩917,154

₩917,154


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
₩917,154

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

₩917,154


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAY

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ARMCX3(51566)

Looking for similar products? Visit Product Comparison Guide

General description

ARMCX3 belongs to armadillo repeat containing, X-linked (ARMCX) subfamily. It is known to be implicated in embryogenesis and tumorigenesis. ARMCX3 gene is mapped to human chromosome Xq21.33-q22.2. This gene encodes a protein ALEX3 (arm-containing protein lost in epithelial cancers linked to the X chromosome) which is known to be localized in cerebral cortex of the nervous system. It is a 379-aa protein consisting of six Arm-like domains which are similar to a DUF463 domain, and an N-terminal region including a transmembrane domain.

Immunogen

Armadillo repeat-containing X-linked protein 3 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Arm-containing protein lost in epithelial cancers linked to the X chromosome (Alex3) regulates mitochondrial trafficking in neurons. The N-terminal region of this protein takes part in mitochondrial targeting and aggregation. ARMCX3 also plays a role as putative tumor suppressor. Interaction of ARMCX3 with Sox10 transcription factor has been suggested to increase the signal transduction cascade between the nucleus and mitochondria.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74069

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Román Serrat et al.
PloS one, 8(7), e67773-e67773 (2013-07-12)
The regulation of mitochondrial dynamics is vital in complex cell types, such as neurons, that transport and localize mitochondria in high energy-demanding cell domains. The Armcx3 gene encodes a mitochondrial-targeted protein (Alex3) that contains several arm-like domains. In a previous
Kazuhiro Daino et al.
International journal of cancer, 125(3), 612-620 (2009-05-16)
To better understand the molecular basis of radiation-induced osteosarcoma (OS), we performed global gene expression profiling of rat OS tumors induced by the bone-seeking alpha emitter (238)Pu, and the expression profiles were compared with those of normal osteoblasts (OB). The
Zhongming Mou et al.
The Journal of biological chemistry, 284(20), 13629-13640 (2009-03-24)
Sox10 is a member of the group E Sox transcription factor family and plays key roles in neural crest development and subsequent cellular differentiation. Sox10 binds to regulatory sequences in target genes via its conserved high mobility group domain. In
Yusuke Kusama et al.
Experimental and therapeutic medicine, 1(2), 395-399 (2010-03-01)
The armadillo family of proteins has been implicated in embryogenesis and tumorigenesis. Armadillo repeat containing X-linked (ARMCX)1-6 and its most closely related protein, ARMC10, share an uncharacterized domain in their carboxyl-terminal region and thereby constitute a unique subfamily. We previously

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service