Skip to Content
Merck
All Photos(13)

Key Documents

HPA000287

Sigma-Aldrich

Anti-GPKOW antibody produced in rabbit

enhanced validation

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-G patch domain and KOW motifs-containing protein antibody produced in rabbit, Anti-G patch domain-containing protein 5 antibody produced in rabbit, Anti-Protein MOS2 homolog antibody produced in rabbit, Anti-Protein T54 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₩917,154

₩917,154


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
₩917,154

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

₩917,154


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, rat, human

enhanced validation

independent
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

ELQSVKPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERENAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GPKOW(27238)

Looking for similar products? Visit Product Comparison Guide

General description

G-patch (glycine-rich) domain and KOW (Kyrpides, Ouzounis and Woese) domain (GPKOW) is a RNA-binding protein that binds to RNA via pathway modulated by PKA (protein kinase A). It is present in human spliceosome. GPKOW is also known as T54 protein or modifier of snc 2 (MOS2) homolog, and it functions as an interaction partner for Cβ2 (C subunit of PKA). The gene is found to be located on human chromosome Xp11. GPKOW protein consists of one G-patch domain and two KOW motifs.

Immunogen

G patch domain and KOW motifs-containing protein recombinant protein epitope signature tag (PrEST)

Application

Anti-GPKOW antibody has been used in Western blotting. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

G-patch (glycine-rich) domain and KOW (Kyrpides, Ouzounis and Woese) domain (GPKOW) plays a crucial role in both alternative splicing and miRNA processing. This RNA binding protein acts as a cofactor for DHX16 (DEAH (Asp-Glu-Ala-His) box polypeptide 16 protein) activity in the spliceosome. The encoded protein also helps in suppressing the splicing defect caused by mutation of DHX16 gene.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74012

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Charles Copeland et al.
Plant signaling & behavior, 8(9), doi:10-doi:10 (2013-06-28)
Plant immunity is essential for plant survival and resistance (R) proteins serve essential roles in pathogen detection and defense signal initiation. A gain-of-function mutation in SNC1, a TIR-type R gene, results in a characteristic autoimmune phenotype in Arabidopsis. From a
Shengbing Zang et al.
Bioscience reports, 34(6), e00163-e00163 (2014-10-09)
Human GPKOW [G-patch (glycine-rich) domain and KOW (Kyrpides, Ouzounis and Woese) domain] protein contains a G-patch domain and two KOW domains, and is a homologue of Arabidopsis MOS2 and Saccharomyces Spp2 protein. GPKOW is found in the human spliceosome, but
Anne Kristin Aksaas et al.
Journal of molecular signaling, 6, 10-10 (2011-09-02)
Post-transcriptional processing of pre-mRNA takes place in several steps and requires involvement of a number of RNA-binding proteins. How pre-mRNA processing is regulated is in large enigmatic. The catalytic (C) subunit of protein kinase A (PKA) is a serine/threonine kinase

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service