Skip to Content
Merck
All Photos(2)

Key Documents

AV48718

Sigma-Aldrich

Anti-SDF2 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Stromal cell-derived factor 2

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₩538,458

₩538,458


Estimated to ship onMay 02, 2025Details



Select a Size

Change View
100 μL
₩538,458

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

₩538,458


Estimated to ship onMay 02, 2025Details


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

21 kDa

species reactivity

horse, rabbit, mouse, dog, bovine, human, guinea pig, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SDF2(6388)

General description

SDF2 codes for stromal cell-derived factor 2 that functions as a secretory protein. Studies in Arabidopsis have revealed that SDF2 regulates unfolded protein response in the endoplasmic reticulum.
Rabbit Anti-SDF2 antibody recognizes bovine, human, mouse, rat, and zebrafish SDF2.

Immunogen

Synthetic peptide directed towards the N terminal region of human SDF2

Application

Rabbit Anti-SDF2 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml and for IHC at 4-8 μg/ml.

Biochem/physiol Actions

SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.

Sequence

Synthetic peptide located within the following region: KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Andrea Schott et al.
The Journal of biological chemistry, 285(23), 18113-18121 (2010-04-10)
Stresses increasing the load of unfolded proteins that enter the endoplasmic reticulum (ER) trigger a protective response termed the unfolded protein response (UPR). Stromal cell-derived factor2 (SDF2)-type proteins are highly conserved throughout the plant and animal kingdoms. In this study
Roland Lehmann et al.
Mucosal immunology, 11(3), 627-642 (2018-01-04)
Protein secretion upon TLR, TNFR1, and IFNGR ligation in the human airways is considered to be central for the orchestration of pulmonary inflammatory and immune responses. In this study, we compared the gene expression and protein secretion profiles in response

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service