Skip to Content
Merck
All Photos(1)

Key Documents

AV13056

Sigma-Aldrich

Anti-RAB3A antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-RAB3A, member RAS oncogene family

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
₩403,869

₩403,869


Estimated to ship onMarch 25, 2025Details



Select a Size

Change View
100 μL
₩403,869

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

₩403,869


Estimated to ship onMarch 25, 2025Details


biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

25 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... RAB3A(5864)

Immunogen

Synthetic peptide directed towards the C terminal region of human RAB3A

Application

Anti- RAB3D antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Biochem/physiol Actions

Rab3A is a synaptic vesicle-associated GTPase that regulates Ca+2-dependent exocytosis. It is ubiquitously present in nervous system and in the acrosomal region of human sperm. Rab3A forms complex with RIM and Munc13 proteins to regulate synaptic vesicles docking and acrosomal exocytosis. It is a regulator of Ca+2-dependent release of α-melanocyte stimulating hormone.

Sequence

Synthetic peptide located within the following region: NVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Simon Sedej et al.
PloS one, 8(10), e78883-e78883 (2013-11-10)
Rab3a is a small GTPase of the Rab3 subfamily that acts during late stages of Ca²⁺-regulated exocytosis. Previous functional analysis in pituitary melanotrophs described Rab3a as a positive regulator of Ca²⁺-dependent exocytosis. However, the precise role of the Rab3a isoform
Oscar D Bello et al.
Experimental cell research, 318(5), 478-488 (2012-01-18)
Exocytosis is a highly regulated, multistage process consisting of multiple functionally definable stages, including recruitment, targeting, tethering, priming, and docking of secretory vesicles with the plasma membrane, followed by calcium-triggered membrane fusion. The acrosome reaction of spermatozoa is a complex
Miao Tian et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 32(20), 6931-6936 (2012-05-18)
Rab3A is a synaptic vesicle-associated protein found throughout the nervous system, but its precise function is unknown. Genetic knock-out studies show that Rab3A is not necessary for vesicular release or replenishment at conventional synapses in the brain. Here we explore

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service