APREST94229

PrEST Antigen CYP27C1

Prestige Antigens Powered by Atlas Antibodies

• Synonym(s): FLJ16008
• UNSPSC Code: 12352203

Properties

• recombinant: expressed in E. coli
• Assay: >80% (SDS-PAGE)
• form: buffered aqueous solution
• mol wt: predicted mol wt 24 kDa
• purified by: immobilized metal affinity chromatography (IMAC)
• concentration: ≥0.5 mg/mL
• immunogen sequence: TTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLK
• Ensembl | human accession no.: ENSG00000186684
• UniProt accession no.: Q4G0S4
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... CYP27C1(339761)

Description

General description

Recombinant protein fragment of Human CYP27C1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag

Application

Blocking agent and positive assay control using corresponding antibodies.

Physical form

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Preparation Note

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable