Skip to Content
Merck
All Photos(6)

Key Documents

Safety Information

HPA008905

Sigma-Aldrich

Anti-DMPK antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-DM-kinase antibody produced in rabbit, Anti-DMK antibody produced in rabbit, Anti-MDPK antibody produced in rabbit, Anti-MT-PK antibody produced in rabbit, Anti-Myotonic dystrophy protein kinase antibody produced in rabbit, Anti-Myotonin-protein kinase antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

LGVFAYEMFYGQTPFYADSTAETYGKIVHYKEHLSLPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVE

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DMPK(1760)

Looking for similar products? Visit Product Comparison Guide

General description

DMPK (dystrophia myotonica protein kinase) gene is localized to human chromosome 19q13.3, which codes for a Ser/Thr kinase. This gene is localized to myotonic dystrophy (DM) locus, and belongs to the myotonic dystrophy proteinkinase family. This gene is composed of 15 exons, and the mRNA is highly alternatively spliced. This gives rise to multiple isoforms of this protein, and they all have in common a leucine-rich domain in N-terminal, a serine/threonine kinase domain, a C-terminal protein kinase domain and a coiled-coil region.

Immunogen

Myotonin-protein kinase recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Expansion of CTG repeats in the 3′ UTR (untranslated region) this gene leads to the disorder Myotonic dystrophy type 1 (DM1). Normally this gene contains 5-37 CTG repeats, whereas DM1 patients contain 50 to several thousand CTG repeats in the 3′UTR. In vitro studies show that adenosinetriphosphate facilitates the unwinding of CTG-duplex repeats by DDX6 (DEAD-box helicase 6) protein. Thus, DDX6 is capable of releasing and remodeling nuclear DMPK messenger ribonucleoprotein foci, which can reverse pathogenic alternative splicing. This protein leads to reorganization of actin cytoskeleton and removal of membrane organelles during differentiation of normal lens. However, in DM1 lenses it results in the retention of the intracellular membrane organelles.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71376

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

HPA008905-100UL:
HPA008905-25UL:


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

S Jin et al.
Cell motility and the cytoskeleton, 45(2), 133-148 (2000-02-05)
DMPK, the product of the DM locus, is a member of the same family of serine-threonine protein kinases as the Rho-associated enzymes. In DM, membrane inclusions accumulate in lens fiber cells producing cataracts. Overexpression of DMPK in cultured lens epithelial
Lisa Kalman et al.
The Journal of molecular diagnostics : JMD, 15(4), 518-525 (2013-05-18)
Myotonic dystrophy type 1 (DM1) is caused by expansion of a CTG triplet repeat in the 3' untranslated region of the DMPK gene that encodes a serine-threonine kinase. Patients with larger repeats tend to have a more severe phenotype. Clinical
DDX6 regulates sequestered nuclear CUG-expanded DMPK-mRNA in dystrophia myotonica type 1.
Pettersson OJ, Aagaard L, Andrejeva D, et al.
Nucleic Acids Research, 42(11), 7186-7200 (2014)
Aline Huguet et al.
PLoS genetics, 8(11), e1003043-e1003043 (2012-12-05)
Myotonic dystrophy type 1 (DM1) is caused by an unstable CTG repeat expansion in the 3'UTR of the DM protein kinase (DMPK) gene. DMPK transcripts carrying CUG expansions form nuclear foci and affect splicing regulation of various RNA transcripts. Furthermore
Ralph J A Oude Ophuis et al.
Muscle & nerve, 40(4), 545-555 (2009-07-25)
Myotonic dystrophy type 1 (DM1) is a neuromuscular disorder caused by an unstable (CTG . CAG)n segment in the 3' untranslated region of the myotonic dystrophy protein kinase (DMPK) gene. It is commonly accepted that DMPK mRNA-based toxicity is the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service