WH0083881M2

Monoclonal Anti-MIXL1 antibody produced in mouse

clone 4D11, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-MGC138179, Anti-MILD1, Anti-MIXL, Anti-Mix1 homeobox-like 1 (Xenopus laevis)
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 4D11, monoclonal
• Stato: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgGκ
• N° accesso Genebanck: NM_031944
• N° accesso UniProt: Q9H2W2
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... MIXL1(83881)

Descrizione

Descrizione generale

Mix paired-like homeobox, also known as mesoderm inducer in Xenopus like 1 (MIXL1), is a homeobox transcription factor. It is induced by the transforming growth factor-β family of ligands. MIXL1 is expressed in hematopoietic stem cells and progenitor cells. The gene encoding it is localized on human chromosome 1q42.12.

Immunogeno

MIXL1 (NP_114150, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QRRKRTSFSAEQLQLLELVFRRTRYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLP

Azioni biochim/fisiol

Mesoderm inducer in Xenopus like 1 (MIXL1) is crucial for specification of the mesoderm and endoderm during early embryogenesis. It modulates the proto-oncogene c-REL. The protein may have a role in acute myelogenous leukemia.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)