WH0054567M4

Monoclonal Anti-DLL4 antibody produced in mouse

clone 2E2, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-MGC126344, Anti-delta-like 4 (Drosophila), Anti-hdelta2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2E2, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_019074
• N° accesso UniProt: Q9NR61
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... DLL4(54567)

Descrizione

Descrizione generale

This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. (provided by RefSeq)

Immunogeno

DLL4 (NP_061947, 123 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPI

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)