WH0051317M1

Monoclonal Anti-PHF21A antibody produced in mouse

clone 5A6, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-BHC80, Anti-BM006, Anti-KIAA1696, Anti-PHD finger protein 21A
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 5A6, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: NM_016621
• N° accesso UniProt: Q96BD5
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PHF21A(51317)

Descrizione

Descrizione generale

BHC80 is a component of a BRAF35 (MIM 605535)/histone deacetylase (HDAC; see MIM 601241) complex (BHC) that mediates repression of neuron-specific genes through the cis-regulatory element known as repressor element-1 (RE1) or neural restrictive silencer (NRS) (Hakimi et al., 2002 [PubMed 12032298]).[supplied by OMIM

Immunogeno

PHF21A (NP_057705, 331 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSLGLVTHDHLEEIQSKRQERKRRTTANPVYSGAVFEPERKKSAVTYLNSTMHPGTRKRA

Azioni biochim/fisiol

The gene PHF21A (PHD finger protein 21A) is also referred to as BHC80 and forms a component of the BRAF-histone deacetylase complex, which is involved in the repression of target-gene transcription. The encoded protein is found to be essential for normal brain development and cognitive function. Disruption of this gene has been found to be associated with developmental delay and craniofacial anomalies that are seen in patients with Potocki–Shaffer syndrome (PSS).

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)