WH0008521M3

Monoclonal Anti-GCM1 antibody produced in mouse

clone 3G7, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-GCMA, Anti-glial cells missing homolog 1 (Drosophila), Anti-hGCMa
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 3G7, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_003643
• N° accesso UniProt: Q9NP62
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... GCM1(8521)

Descrizione

Descrizione generale

The gene GCM1 (glial cells missing homolog 1) is mapped to human chromosome 6p12. It belongs to the glial cells missing (GCM) family. GCM1 is present in villous cytotrophoblast cells, the syncytiotrophoblast layer and extravillous trophoblast cells.

Immunogeno

GCM1 (NP_003634, 108 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*

Azioni biochim/fisiol

GCM1 (glial cells missing homolog 1) is a transcription factor that is specific for placenta. It plays an important role in trophoblast cell fusion and invasion by enhancing the expression of syncytin-1 and syncytin-2 fusogenic proteins and high-temperature requirement protein A4 (HtrA4), a serine protease. Disruption in the activity of this gene can result in defective placental development, thereby leading to embryonic death.

Caratteristiche e vantaggi

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)