Passa al contenuto
Merck
Tutte le immagini(6)

Documenti

WH0007001M1

Sigma-Aldrich

Monoclonal Anti-PRDX2 antibody produced in mouse

clone 4E10-2D2, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-MGC4104, Anti-NKEFB, Anti-PRP, Anti-PRXII, Anti-Peroxiredoxin 2, Anti-TDPX1, Anti-TSA

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(6)

About This Item

Numero MDL:
MFCD00162725
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

4E10-2D2, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

human

tecniche

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG1κ

N° accesso Genebanck

BC000452

N° accesso UniProt

P32119

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PRDX2(7001)

Descrizione generale

Peroxiredoxin 2 (PRDX2) is an antioxidant protein that belongs to the peroxiredoxins family. It is associated with mammalian erythrocytes. The PRDX2 gene is mapped to human chromosome19p13.13.

Immunogeno

PRDX2 (AAH00452, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Applicazioni

Monoclonal Anti-PRDX2 antibody produced in mouse has been used in western blotting (1:1000).

Azioni biochim/fisiol

Peroxiredoxin 2 (PRDX2) effectively neutralizes hydrogen peroxide (H2O2 ). It is regarded as a critical cell survival modulator and may serve as a key regulator for cell proliferation and intracellular signaling. Downregulated expression of PRDX2 is observed in acute myeloid leukemia (AML) and melanoma. However, it acts as an oncogene in the pathophysiology of various cancers including non-small cell lung cancer (NSCLC), esophageal, cervical, gastric tumors, and many more.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Ting Duan et al.
Molecular medicine reports, 13(6), 4807-4813 (2016-04-16)
Late‑onset hypogonadism is defined as a condition caused by a decline in the levels of testosterone with aging. One of the major factors contributing to the low levels of testosterone is the accumulation of reactive oxygen species (ROS) in Leydig
Kumarasamypet M Mohankumar et al.
Nature genetics, 47(8), 878-887 (2015-06-16)
Cancers are characterized by non-random chromosome copy number alterations that presumably contain oncogenes and tumor-suppressor genes (TSGs). The affected loci are often large, making it difficult to pinpoint which genes are driving the cancer. Here we report a cross-species in
Yun Chen et al.
BioMed research international, 2020, 8359860-8359860 (2020-09-11)
Previous studies have reported that the levels of PRDX2 were correlated with tumorigenicity, recurrence, and prognosis of patients with different cancers. We investigated the association between PRDX2 levels and the prognosis of lung cancer patients. We also measured PRDX2 expression
Trung Nghia Vo et al.
Antioxidants (Basel, Switzerland), 10(7) (2021-07-03)
Hydrogen peroxide (H2O2) is a key redox signaling molecule that selectively oxidizes cysteines on proteins. It can accomplish this even in the presence of highly efficient and abundant H2O2 scavengers, peroxiredoxins (Prdxs), as it is the Prdxs themselves that transfer
Ting Luo et al.
Redox biology, 46, 102066-102066 (2021-08-03)
Hydrogen peroxide (H2O2) acts as a signalling molecule by oxidising cysteine thiols in proteins. Recent evidence has established a role for cytosolic peroxiredoxins in transmitting H2O2-based oxidation to a multitude of target proteins. Moreover, it is becoming clear that peroxiredoxins
Visualizza tutti i documenti correlati

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.