SAB5702342

[KO Validated]Anti-STAT2 Antibody, clone 4A5P8, Rabbit Monoclonal

• Sinonimo/i: IMD44, ISGF-3, P113, STAT113
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 4A5P8, monoclonal
• Forma fisica: liquid
• Reattività contro le specie: human, rat
• Concentrazione: 1 mg/mL
• tecniche: western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: KLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDEL
• N° accesso UniProt: P52630
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... STAT2(6773)

Descrizione

Descrizione generale

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. Transcription adaptor P300/CBP (EP300/CREBBP) has been shown to interact specifically with this protein, which is thought to be involved in the process of blocking IFN-alpha response by adenovirus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]

Immunogeno

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 550-706 of human STAT2 (NP_005410.1).

Applicazioni

WB

Informazioni sulla sicurezza

• Pittogrammi: GHS07,GHS09
• Avvertenze: Warning
• Indicazioni di pericolo: H317,H411
• Consigli di prudenza: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classi di pericolo: Aquatic Chronic 2 - Skin Sens. 1
• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3