SAB2108487

Anti-BTG2

affinity isolated antibody

• Sinonimo/i: Anti- MGC126064, Anti- PC3, Anti- TIS21, Anti-MGC126063
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 17 kDa
• Reattività contro le specie: rat, human
• Concentrazione: 0.5-1 mg/mL
• tecniche: immunoblotting: suitable
• Numero d’accesso: NM_006763
• N° accesso UniProt: P78543
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... BTG2(7832)

Descrizione

Descrizione generale

B-cell translocation gene 2 (BTG2) belongs to the BTG/TOB gene family. It is also called as nerve growth factor (NGF)-inducible anti-proliferative protein PC3 and NGF-inducible protein TIS21. BTG2 encodes a 158 amino acid protein. This gene is located on the long arm of human chromosome 1.

Immunogeno

Synthetic peptide directed towards the middle region of human BTG2

Azioni biochim/fisiol

B-cell translocation gene 2 (BTG2) is an anti-proliferative protein. BTG2 modulates transcription regulation mediated by ESR1.
It participates in the modulation of cell cycle transition. It has the ability to repress the migration and invasion of osteosarcoma cells.

Sequenza

Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable