SAB2103568

Anti-LCN1 antibody produced in rabbit

affinity isolated antibody, lyophilized powder

• Sinonimo/i: Anti-MGC71975, Anti-PMFA, Anti-TP, Anti-VEGP
• Numero MDL: MFCD01864741
• Codice UNSPSC: 12352203

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: lyophilized powder
• PM: 17 kDa
• Reattività contro le specie: mouse, human, rat, pig
• tecniche: western blot: suitable
• Sequenza immunogenica: IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG
• N° accesso NCBI: NM_002297
• N° accesso UniProt: P31025
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... LCN1(3933)

Descrizione

Immunogeno

Peptide region of the protein sequence according to NP_002288.

Stato fisico

Antibody is lyophilized from PBS buffer with 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable