Passa al contenuto
Merck
Tutte le immagini(2)

Documenti

SAB2103221

Sigma-Aldrich

Anti-ATP6V0D2 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-ATP6D2, Anti-FLJ38708, Anti-VMA6

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

40 kDa

Reattività contro le specie

mouse, human, guinea pig, dog, rabbit, rat

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NM_152565

N° accesso UniProt

Q8N8Y2

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... ATP6V0D2(245972)

Categorie correlate

Descrizione generale

Adenosine triphosphatase V0 (ATP6V0D2) is located on human chromosome 8q21. Atp6v0d2 is an isoform of vacuolar (H+) ATPase (v-ATPase) proton pump. ATP6V0D2 is expressed abundantly in mature osteoclasts.

Immunogeno

Synthetic peptide directed towards the middle region of human ATP6V0D2

Azioni biochim/fisiol

Adenosine triphosphatase V0 (ATP6V0D2) helps in osteoclast maturation and bone formation. Insulin activates ATP6V0D2 through extracellular-signal-regulated kinase (ERK)1/2 pathway.

Sequenza

Synthetic peptide located within the following region: MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

v-ATPase V 0 subunit d2-deficient mice exhibit impaired osteoclast fusion and increased bone formation
Lee, Seou, et al.
Nature Medicine, 12(12), 1403-1403 (2006)
Insulin enhances RANKL-induced osteoclastogenesis via ERK1/2 activation and induction of NFATc1 and Atp6v0d2
Oh, Ju He, et al.
Cellular Signalling, 27(12), 2325-2331 (2015)
Integrated differential transcriptome maps of Acute Megakaryoblastic Leukemia (AMKL) in children with or without Down Syndrome (DS)
Pelleri,, et al.
BMC Medical Genomics, 7(1), 63-63 (2014)
Na Liu et al.
The Journal of clinical investigation, 129(2), 631-646 (2018-11-16)
Macrophages perform key functions in tissue homeostasis that are influenced by the local tissue environment. Within the tumor microenvironment, tumor-associated macrophages can be altered to acquire properties that enhance tumor growth. Here, we found that lactate, a metabolite found in
Weihao Zheng et al.
PLoS pathogens, 20(5), e1012205-e1012205 (2024-05-03)
Mycobacterium tuberculosis (Mtb) infects lung myeloid cells, but the specific Mtb-permissive cells and host mechanisms supporting Mtb persistence during chronic infection are incompletely characterized. We report that after the development of T cell responses, CD11clo monocyte-derived cells harbor more live
Visualizza tutti i documenti correlati

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.