SAB1412632

ANTI-ZIC3 antibody produced in mouse

clone 2D3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: HTX, HTX1, ZIC3, ZNF203
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2D3, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen 35.86 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2bκ
• N° accesso NCBI: NM_003413
• N° accesso UniProt: O60481
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ZIC3(7547)

Descrizione

Descrizione generale

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs. (provided by RefSeq)

Immunogeno

ZIC3 (NP_003404.1, 182 a.a. ~ 274 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable