SAB1412326

ANTI-AHR antibody produced in mouse

clone 3B9, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: AHR, bHLHe76
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 3B9, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen 36.41 kDa
• Reattività contro le specie: human
• tecniche: immunohistochemistry: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_001621
• N° accesso UniProt: P35869
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... AHR(196)

Descrizione

Descrizione generale

This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. (provided by RefSeq)

Immunogeno

AHR (NP_001612, 279 a.a. ~ 376 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EIRTKNFIFRTKHKLDFTPIGCDAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRWTWVQSNARLLYKNGRP

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable