SAB1409662

Monoclonal Anti-RBM15 antibody produced in mouse

clone 2C1, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: FLJ12479, FLJ21943, MGC119584, OTT, OTT1, SPEN
• Codice UNSPSC: 12352203
• NACRES: NA.43

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2C1, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen 37.84 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable
• Isotipo: IgG1κ
• N° accesso NCBI: NM_022768
• N° accesso UniProt: Q96T37
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... RBM15(64783)

Descrizione

Descrizione generale

Members of the SPEN (Split-end) family of proteins, including RBM15, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).[supplied by OMIM

Immunogeno

RBM15 (NP_073605.4, 701 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDL

Azioni biochim/fisiol

RBM15 (RNA binding motif protein 15) is an RTE (RNA transport element) binding factor majorly involved in the mRNA export. It plays a vital role in the NXF (Nuclear export factor) pathway. It directly binds to NXF1 and provides receptor for the RNA export element RTE. This conjugated form helps to enhance RTE-mediated expression. RBM15 has the ability to identify specific RTE RNA in vitro, which finally enhances export and expression of RTE-containing reporter mRNAs in vivo.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable