SAB1407297

Anti-LRRC29 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: FBL9, FBXL9
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: antigen ~23.8 kDa
• Reattività contro le specie: human
• tecniche: western blot: 1 μg/mL
• N° accesso NCBI: NM_001004055.1
• N° accesso UniProt: Q8WV35
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... LRRC29(26231)

Descrizione

Descrizione generale

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 9 tandem leucine-rich repeats. Two transcript variants encoding the same protein have been found for this gene. Other variants may occur, but their full-length natures have not been characterized. (provided by RefSeq)

Immunogeno

LRRC29 (NP_001004055.1, 1 a.a. ~ 223 a.a) full-length human protein.

Sequence
MYSSGWPAGAAEPRHGRGRELAQALGCMHGAPSQLASLSLAHCSSLKSRPELEHQASGTKDACPEPQGPSLLTLRALQELDLTACSKLTDASLAKVLQFLQLRQLSLSLLPELTDNGLVAVARGCPSLEHLALSHCSRLSDKGWAQAASSWPRLQHLNLSSCSQLIEQTLDAIGQACRQLRVLDVATCPGINMAAVRRFQAQLPQVSCVQSRFVGGADLTLTL

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable