SAB1404882

Monoclonal Anti-STIP1, (C-terminal) antibody produced in mouse

clone 1E3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: HOP, IEF-SSP-3521, P60, STI1, STI1L
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1E3, monoclonal
• Stato: buffered aqueous solution
• PM: antigen ~37 kDa
• Reattività contro le specie: rat, mouse, human
• tecniche: capture ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_006819
• N° accesso UniProt: P31948
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... STIP1(10963)

Descrizione

Descrizione generale

STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM

Immunogeno

STIP1 (NP_006810.1, 445 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable