SAB1402677

Monoclonal Anti-ABCA1 antibody produced in mouse

clone 1H4, ascites fluid

• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: ascites fluid
• Tipo di anticorpo: primary antibodies
• Clone: 1H4, monoclonal
• PM: antigen ~37.11 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable
• Isotipo: IgMκ
• N° accesso NCBI: NM_005502
• N° accesso UniProt: O95477
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ABCA1(19)

Descrizione

Descrizione generale

ATP binding cassette subfamily A member 1 (ABCA1) is encoded by the gene mapped to human chromosome 9q31.1. The encoded protein belongs to the ATP-binding cassette (ABC)1 family of membrane transporters.

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesteral efflux pump in the cellular lipid removal pathway. Mutations in this gene have been associated with Tangier′s disease and familial high-density lipoprotein deficiency. (provided by RefSeq)

Immunogeno

ABCA1 (NP_005493, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQ

Applicazioni

Monoclonal Anti-ABCA1 antibody produced in mouse has been used in confocal laser scanning microscopy and Western blot technique.

Azioni biochim/fisiol

ATP binding cassette subfamily A member 1 (ABCA1) functions as a phospholipid and/or cholesterol transporter. ABCA1 interacts with its ligand apolipoprotein to regulate cholesterol trafficking. Mutation in the gene is associated with the development of Tangier disease and familial hypoalipoproteinemia.

Stato fisico

Clear solution

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 11 - Combustible Solids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable