SAB1402421

Monoclonal Anti-SMARCA5 antibody produced in mouse

clone 3F4, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: ISWI, SNF2H, WCRF135, hISWI, hSNF2H
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 3F4, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen ~35.9 kDa
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_003601
• N° accesso UniProt: O60264
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SMARCA5(8467)

Descrizione

Descrizione generale

The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. (provided by RefSeq)

Immunogeno

SMARCA5 (NP_003592, 59 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTE

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable