SAB1401050

Monoclonal Anti-CCNT2 antibody produced in mouse

clone 1H3, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: FLJ90560, MGC134840
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1H3, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_058241
• N° accesso UniProt: O60583
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CCNT2(905)

Descrizione

Descrizione generale

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin and its kinase partner CDK9 were found to be subunits of the transcription elongation factor p-TEFb. The p-TEFb complex containing this cyclin was reported to interact with, and act as a negative regulator of human immunodeficiency virus type 1 (HIV-1) Tat protein. Two alternatively spliced transcript variants, which encode distinct isoforms, have been described. (provided by RefSeq)

Immunogeno

CCNT2 (NP_490595, 264 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSARTEQLYSQKQET

Azioni biochim/fisiol

Cyclin T2 (CCNT2) is required as a cofactor and activator. It has roles in different cellular pathways such as transcriptional elongation, differentiation and apoptosis. CCNT2 phosphorylates the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNAP II).

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable