Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

SAB1400775

Sigma-Aldrich

Anti-CDCA5 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

Sinonimo/i:

Anti-MGC16386

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

indirect immunofluorescence: suitable
western blot: 1 μg/mL

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... CDCA5(113130)

Descrizione generale

CDCA5 (cell division cycle associated 5) gene is mapped to human chromosome 11q13.1. The gene codes for the protein sororin. The protein is localized in the nucleus. It is known to be conserved among the vertebrates.

Immunogeno

CDCA5 (NP_542399.1, 1 a.a. ~ 252 a.a) full-length human protein.

Sequence
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE

Azioni biochim/fisiol

Sororin regulates proper cohesion and separation of sister chromatids during replication, by stabilizing cohesin on DNA. Phosphorylation of sororin by cyclin B during mitosis, reduces its potential to prevent Wap1 (cohesin release factor) and Pds5 (cohesin-interacting protein) binding.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Genomic alterations identified by array comparative genomic hybridization as prognostic markers in tamoxifen-treated estrogen receptor-positive breast cancer.
Han W
BMC Cancer, 6:92, 1-13 (2006)
C-terminus of Sororin interacts with SA2 and regulates sister chromatid cohesion.
Zhang N and Pati D
Cell Cycle, 14(6), 820-826 (2015)
Interaction of Sororin protein with polo-like kinase 1 mediates resolution of chromosomal arm cohesion.
Zhang N.
The Journal of Biological Chemistry, 286(48), 41826-41837 (2011)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.