SAB1400646

Anti-SH3GLB2 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

• Sinonimo/i: Anti-KIAA1848
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: suitable; western blot: 1 μg/mL
• N° accesso UniProt: Q9NR46
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SH3GLB2(56904)

Descrizione

Descrizione generale

The gene SH3GLB2 (SH3 domain-containing GRB2-like protein B2) is mapped to human chromosome 9q34. The encoded protein belongs to the endophilin family of BAR and Src homology 3 domain-containing proteins. SH3GLB2 localizes in the meshwork of perinuclear filamentous structures. The protein contains an N-BAR (bin, amphiphysin and rvs) domain and a SH3 (src homology 3) domain.

Immunogeno

SH3GLB2 (NP_064530.1, 1 a.a. ~ 395 a.a) full-length human protein.

Sequence
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSARVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAVATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS

Azioni biochim/fisiol

SH3GLB2 (SH3 domain-containing GRB2-like protein B2) associates with SH3GLB1. It also interacts with plectin-1 and vimentin. SH3GLB2 is involved in reorganization of vimentin around nuclei and nuclear positioning.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable