SAB1400224

Anti-PRPSAP2 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

• Sinonimo/i: Anti-MGC117304, Anti-MGC126719, Anti-MGC126721, Anti-PAP41
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect immunofluorescence: suitable; western blot: 1 μg/mL
• N° accesso UniProt: O60256
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PRPSAP2(5636)

Descrizione

Descrizione generale

The enzyme phosphoribosylpyrophosphate synthetase (PRS) catalyzes the formation of phosphoribosylpyrophosphate which is a substrate for synthesis of purine and pyrimidine nucleotides, histidine, tryptophan and NAD. PRS exists as a complex with two catalytic subunits and two associated subunits. This gene encodes a non-catalytic associated subunit of PRS. (provided by RefSeq)

Immunogeno

PRPSAP2 (NP_002758.1, 1 a.a. ~ 369 a.a) full-length human protein.

Sequence
MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD

Azioni biochim/fisiol

PRPSAP2 (Phosphoribosyl pyrophosphate synthetase-associated protein 2) is highly involved in the biogenesis of purine and pyrimidine nucleotids, histidine and tryptophan, and NAD (Nicotinamide adenine dinucleotide). It acts as a primary substrate during nucleotide synthesis.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable