Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

SAB1400130

Sigma-Aldrich

Anti-HSD17B2 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

Sinonimo/i:

Anti-EDH17B2, Anti-HSD17

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

western blot: 1 μg/mL

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... HSD17B2(3294)

Descrizione generale

HSD17B2 (Hydroxysteroid 17-ß dehydrogenase 2) is a member of the short chain alcohol dehydrogenase superfamily, expressed in non-steroidogenic human embryonic kidney cells.

Immunogeno

HSD17B2 (NP_002144.1, 1 a.a. ~ 387 a.a) full-length human protein.

Sequence
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKAT

Azioni biochim/fisiol

HSD17B2 (Hydroxysteroid 17-β dehydrogenase 2) is highly involved in the synthesis and metabolism of steroid hormones. It maintains the intracellular concentration of biologically active steroid hormones in a wide range of male and female human tissues. It catalyzes the interconversion of testosterone and androstenedione as well as estradiol and estrone through 17-β HSD activities. HSD17B2 also of 20α-HSD activity towards 20α-dihydroprogesterone.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Frauke Beilstein et al.
PloS one, 8(1), e53017-e53017 (2013-01-10)
In enterocytes, the dynamic accumulation and depletion of triacylglycerol (TAG) in lipid droplets (LD) during fat absorption suggests that cytosolic LD-associated TAG contribute to TAG-rich lipoprotein (TRL) production. To get insight into the mechanisms controlling the storage/secretion balance of TAG
L Wu et al.
The Journal of biological chemistry, 268(17), 12964-12969 (1993-06-15)
17 beta-Hydroxysteroid dehydrogenase (17 beta-HSD) is an enzyme crucial to the regulation of intracellular levels of biologically active steroid hormones in a variety of tissues. Here, we report the isolation, structure, and characterization of a cDNA encoding the human 17

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.