HPA019953

Anti-PPM1L antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

• Sinonimo/i: Anti-PP2C-epsilon, Anti-Protein phosphatase 1-like, Anti-Protein phosphatase 1L, Anti-Protein phosphatase 2C isoform epsilon
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA019953
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• Sequenza immunogenica: DLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSK
• N° accesso UniProt: Q5SGD2
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... PPM1L(151742)

Descrizione

Descrizione generale

PPM1L (Protein phosphatase, Mg2+/Mn2+ dependent 1L) is a novel serine-threonine phosphatase belonging to PP2C family.

Immunogeno

Protein phosphatase 1L recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-PPM1L antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

PPM1L (Protein phosphatase, Mg²⁺/Mn²⁺ dependent 1L) is involved in the H₂O₂-induced regulation of ASK1 signaling. It suppresses gene expression of SAPK (stress-activated protein kinase) by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5. It is also associated with the regulation of the TGF-β and BMP (Bone Morphogenetic Protein) signaling pathways.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73644

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable