HPA017206

Anti-CAMK4 antibody produced in rabbit

affinity isolated antibody, Prestige Antibodies^® Powered by Atlas Antibodies, buffered aqueous glycerol solution

• Sinonimo/i: Anti-CAM kinase-GR, Anti-CaMK IV, Anti-Calcium/calmodulin-dependent protein kinase type IV
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA017206
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• Sequenza immunogenica: GIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSS
• N° accesso UniProt: Q16566
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CAMK4(814)

Descrizione

Immunogeno

Calcium/calmodulin-dependent protein kinase type IV recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-CAMK4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

CAMK4 (calcium/calmodulin-dependent protein kinase IV) is a multifunctional serine/threonine protein kinase belonging to the CaMK family. It is a Ca²⁺ sensor molecule that enters the nucleus via adapter protein, importin-α. It binds to and activates calcium response-element binding (CREB) protein by phosphorylation for gene transcriptional regulation. It can also control alternate splicing by interacting with the ribonuclear protein L. The hippocampus and cerebellum of the CNS (central nervous system) that are responsible for long-term depression (LTD), dendritic growth, and the acquisition of memories are regulated by CAMK4. It also controls the phosphorylation of protamines during spermatogenesis, in terms of, controlling human sperm motility. Thus, a mutation in CAMK4 causes the infertility in men due to abnormal semen activity.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71434

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)