HPA009083

Anti-ICAM5 antibody produced in rabbit

Ab2, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-ICAM-5 antibody produced in rabbit, Anti-Intercellular adhesion molecule 5 precursor antibody produced in rabbit, Anti-Telencephalin antibody produced in rabbit
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA009083
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunohistochemistry: 1:50- 1:200
• Sequenza immunogenica: PPEMDESTCPSHQTWLEGAEASALACAARGRPSPGVRCSREGIPWPEQQRVSREDAGTYHCVATNAHGTDSRTVTVGVEYRPVVAELAASPPGGVRPGGNFTLTCR
• N° accesso UniProt: Q9UMF0
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ICAM5(7087)

Descrizione

Descrizione generale

ICAM5 (intercellular adhesion molecule 5), also called telencephalin, is a neuronal cell adhesion molecule belonging to the ICAM family. This gene is localized to human chromosome 19p13.2 and spans 80kb. It is a glycoprotein, which is polarized towards the dendrites. This protein is composed of nine exoplasmic Ig (immunoglobulin) domain consisting of 832 amino acids. It is also composed of a transmembrane region of 28 amino acids, and a 64 amino acid-cytosolic region. It is exclusively expressed by neurons of telencephalon, which is the most rostral region of brain.

Immunogeno

Intercellular adhesion molecule 5 precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Azioni biochim/fisiol

ICAM5 (intercellular adhesion molecule 5) shows hemophilic between neurons through binding between Ig (immunoglobulin) domain 1 to domain 4-5. It also interacts in a heterophilic manner with β₂-integrins present on leukocytes. This proteinis involved in the arborization of hippocampal neurons and the outgrowth of dendrites. This protein interacts with LFA-1 (lymphocyte function-associated antigen-1) integrin present on microglia, which helps microglial spreading and regulates the function of microglia in both physiological and pathological conditions. Meta-analysis studies show that V301I and rs281439 polymorphisms in ICAM5 gene are responsible for susceptibility to breast cancer. This protein also functions as an anti-inflammatory agent in brain, where T-cell activation results in its cleavage from neurons.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71735

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)