HPA005661

Anti-ADAMTS5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-A disintegrin and metalloproteinase with thrombospondin motifs 5 antibody produced in rabbit, Anti-ADAM-TS 11 antibody produced in rabbit, Anti-ADAM-TS 5 antibody produced in rabbit, Anti-ADAM-TS5 antibody produced in rabbit, Anti-ADAMTS-5 precursor antibody produced in rabbit, Anti-ADMP-2 antibody produced in rabbit, Anti-Aggrecanase-2 antibody produced in rabbit
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA005661
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunohistochemistry: 1:50- 1:200
• Sequenza immunogenica: KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGS
• N° accesso UniProt: Q9UNA0
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ADAMTS5(11096)

Descrizione

Descrizione generale

ADAM metallopeptidase with thrombospondin motifs 5 (ADAMTS5) belongs to the ADAM protein family. It has an ADAM-like protease domain, a disintegrin-like domain and a cysteine-rich domain. ADAMTS5 lacks a transmembrane domain and is thus secreted into the extracellular matrix.

Immunogeno

A disintegrin and metalloproteinase with thrombospondin motifs 5 precursor (ADAMTS-5) (ADAM-TS5) (Aggrecanase-2) (ADMP-2) (A disintegrin and metalloproteinase with thrombospondin motifs 11) (ADAMTS-11)

Applicazioni

Anti-ADAMTS5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

ADAM metallopeptidase with thrombospondin motifs 5 (ADAMTS5) is involved in aggrecan, brevican and α2-macroglobulin degradation. It is one of the most important extra cellular matrix (ECM) degrading enzymes and functions in tissue degradation, remodeling and cell infiltration. ADAMTS5 cleaves cartilage aggrecan at the Glu (373)-Ala (374) bond and also in the region spanning residues Gly (1481) and Glu (1667), which represents its unique cleavage site.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85176

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)