HPA005482

Anti-IL17RB antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Cytokine receptor CRL4, Anti-IL-17 receptor B, Anti-IL-17 receptor homolog 1, Anti-IL-17B receptor, Anti-IL-17RB, Anti-IL-17Rh1, Anti-IL17Rh1, Anti-Interleukin-17 receptor B precursor, Anti-Interleukin-17B receptor
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA005482
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma fisica: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunohistochemistry: 1:50-1:200
• Sequenza immunogenica: QCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPG
• N° accesso UniProt: Q9NRM6
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... IL17RB(55540)

Descrizione

Descrizione generale

Interleukin 17 receptor B (IL17RB) is a member of the IL-17 receptor (IL17R) family. It makes a heterodimeric receptor complex along with IL17RA. This family of proteins has a single transmembrane domain, which contains fibronectin type-III (FnIII) domain. They have an extracellular domain and a cytosolic domain which contains the unique SEFIR [SEF (similar expression to fibroblast growth factor genes) and IL-17R] domain. IL17RB acts as a receptor for IL17B as well as IL17E. In humans, this gene is located on chromosome 3p21.1. The molecular weight of IL17RB is 56kDa. It is expressed on lung fibroblasts, basophils along with CD4⁺ Th2 memory cells.

Immunogeno

Interleukin-17 receptor B precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-IL17RB antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

Interleukin 17 receptor B (IL17RB) expression is induced by Th2 cytokines, in antigen presenting cells. Induction of IL17RB leads to inflammatory responses via activation of Jun kinase (JNK), nuclear factor-κB and p38 mitogen-activated protein kinase (MAPK). Therefore, polymorphisms in this gene are associated with asthma, and can be used as markers to determine the risk of developing asthma. Studies suggest that IL17RB is the only gene, whose transcription varies in accordance with the IgE levels in asthmatics. Exposure to natural allergens leads to elevated levels of IL17RB in patients with seasonal allergic rhinitis (SAR). Blocking of this protein prevents lung inflammation and thus, IL17RB can be a potential therapeutic target for allergies.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86465

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)