Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV51642

Sigma-Aldrich

Anti-PAXIP1 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-CAGF28, Anti-CAGF29, Anti-FLJ41049, Anti-PACIP1, Anti-PAX interacting (with transcription-activation domain) protein 1, Anti-PAXIP1L, Anti-PTIP, Anti-TNRC2

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

74 kDa

Reattività contro le specie

rat, guinea pig, rabbit, horse, human, dog, bovine, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PAXIP1(22976)

Immunogeno

Synthetic peptide directed towards the N terminal region of human PAXIP1

Applicazioni

Anti-PAXIP1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Azioni biochim/fisiol

PAX interacting (with transcription-activation domain) protein 1 (PAXIP1) is a nuclear protein that belongs to the paired box gene family. It is characterized by six breast cancer carboxy-terminal (BRCT) domains. PAXIP1 is involved in chromatin condensation during mitosis and maintenance of genome stability.

Sequenza

Synthetic peptide located within the following region: MFDDSSDSSPEKQERNLNWTPAEVPQLAAAKRRLPQGKEPGLINLCANVP

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Eun Ah Cho et al.
Molecular and cellular biology, 23(5), 1666-1673 (2003-02-18)
The Pax transactivation domain-interacting protein (PTIP) is a large nuclear protein with multiple BRCT domains that was identified on the basis of its interaction with transcription factors of the Pax and Smad families. To address the function of PTIP during
Ivan M Munoz et al.
Nucleic acids research, 35(16), 5312-5322 (2007-08-11)
Human (h)PTIP plays important but poorly understood roles in cellular responses to DNA damage. hPTIP interacts with 53BP1 tumour suppressor but only when 53BP1 is phosphorylated by ATM after DNA damage although the mechanism(s) and significance of the interaction of

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.