Passa al contenuto
Merck
Tutte le immagini(2)

Key Documents

AV50512

Sigma-Aldrich

Anti-ING1 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Inhibitor of growth family, member 1, Anti-p24ING1c, Anti-p33, Anti-p33ING1, Anti-p33ING1b, Anti-p47, Anti-p47ING1a

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

32 kDa

Reattività contro le specie

dog, human, guinea pig, bovine, rat, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_005528

N° accesso UniProt

Q5T9H0

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... ING1(3621)

Immunogeno

Synthetic peptide directed towards the C terminal region of human ING1

Applicazioni

Anti-ING1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Azioni biochim/fisiol

Inhibitor of growth family, member 1 (ING1; p47; p33) is a nuclear protein with tumor suppressor activity. It interacts with p53, participates in p53-mediated signaling and regulates cell growth and apoptosis. However, ING1 also acts independent of p53; translocates to mitochondria and induces apoptosis by altering mitochondrial membrane potential.

Sequenza

Synthetic peptide located within the following region: EKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCD

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

P Bose et al.
Cell death & disease, 4, e788-e788 (2013-09-07)
The ING family of tumor suppressors acts as readers and writers of the histone epigenetic code, affecting DNA repair, chromatin remodeling, cellular senescence, cell cycle regulation and apoptosis. The best characterized member of the ING family, ING1,interacts with the proliferating
Julieta M Ceruti et al.
Molecular and cellular biochemistry, 378(1-2), 117-126 (2013-03-06)
ING proteins are tumor suppressors involved in the regulation of gene transcription, cell cycle arrest, apoptosis, and senescence. Here, we show that ING1b expression is upregulated by several DNA-damaging agents, in a p53-independent manner. ING1b stimulates DNA repair of a

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.