AV50505
Anti-AIM2 antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-Absent in melanoma 2, Anti-PYHIN4
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Origine biologica
rabbit
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
39 kDa
Reattività contro le specie
human, horse
Concentrazione
0.5 mg - 1 mg/mL
tecniche
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... AIM2(9447)
Descrizione generale
The gene AIM2 (Absent in melanoma 2) is mapped to human chromosome 1q22. It belongs to the IFI20X /IFI16 family. AIM2 transcripts are detected in spleen, small intestine, testis and peripheral blood leukocytes.
Immunogeno
Synthetic peptide directed towards the N terminal region of human AIM2
Applicazioni
Anti-AIM2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Azioni biochim/fisiol
Absent in melanoma 2 (AIM2) is induced by IFN-γ. The probable roles of AIM2 are regulation of cell proliferation, inflammation and benign prostate hyperplasia. It also suppresses proliferation and tumorigenicity of human breast cancer cells. AIM2 is a suppressor of melanoma tumorigenicity. AIM2 is up-regulated in humans with hepatitis B virus-associated glomerulonephritis. AIM2 expression was positively correlated with caspase-1 and IL (Interleukin)-1β expression. AIM2 is also a component of inflammasome and can sense cytoplasmic DNA, causing activation of ASC (apoptosis-associated speck-like protein containing a CARD) pyroptosome and caspase-1.
Sequenza
Synthetic peptide located within the following region: ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
12 - Non Combustible Liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Larissa Ponomareva et al.
Molecular cancer research : MCR, 11(10), 1193-1202 (2013-07-19)
Close links have been noted between chronic inflammation of the prostate and the development of human prostatic diseases such as benign prostate hyperplasia (BPH) and prostate cancer. However, the molecular mechanisms that contribute to prostatic inflammation remain largely unexplored. Recent
Junhui Zhen et al.
Mediators of inflammation, 2014, 190860-190860 (2014-04-05)
AIM2 plays an important role in innate immunity, but its role in regulating the immune response to hepatitis B virus (HBV) is unknown. We hypothesized that AIM2 expression is positively correlated with HBV-mediated inflammation in patients with HBV-associated glomerulonephritis (HBV-GN)
I-Fen Chen et al.
Molecular cancer therapeutics, 5(1), 1-7 (2006-01-25)
IFN-inducible proteins are known to mediate IFN-directed antitumor effects. The human IFN-inducible protein absent in melanoma 2 (AIM2) gene encodes a 39-kDa protein, which contains a 200-amino-acid repeat as a signature of HIN-200 family (hematopoietic IFN-inducible nuclear proteins). Although AIM2
K L DeYoung et al.
Oncogene, 15(4), 453-457 (1997-07-24)
Chromosome 6-mediated suppression of tumorigenicity in malignant melanoma cell lines provides a model system to identify genes associated with the reversion of the tumorigenic phenotype. Using subtractive cDNA selection, we recently identified a series of novel genes which are differentially
Teresa Fernandes-Alnemri et al.
Nature, 458(7237), 509-513 (2009-01-23)
Host- and pathogen-associated cytoplasmic double-stranded DNA triggers the activation of a NALP3 (also known as cryopyrin and NLRP3)-independent inflammasome, which activates caspase-1 leading to maturation of pro-interleukin-1beta and inflammation. The nature of the cytoplasmic-DNA-sensing inflammasome is currently unknown. Here we
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.