Passa al contenuto
Merck
Tutte le immagini(2)

Documenti

AV46418

Sigma-Aldrich

Anti-TMPRSS11D antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-HAT, Anti-MGC150587, Anti-MGC150588, Anti-Transmembrane protease, serine 11D

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

46 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_004253

N° accesso UniProt

O60235

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... TMPRSS11D(9407)

Immunogeno

Synthetic peptide directed towards the N terminal region of human TMPRSS11D

Applicazioni

Anti-TMPRSS11D antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml. It is also useful for immunohistochemistry at a concentration of 4-8μg/ml.

Azioni biochim/fisiol

TMPRSS11D (transmembrane protease, serine 11D) gene also referred to as MGC150587, MGC150588 or HAT(human airway trypsin-like protease) encodes for a 418 amino acid containing type II integral membrane protein. HAT stimulates amphiregulin (AR) production via protease-activated receptor-2 (PAR-2) mediated ERK pathway and then releases it by TACE (tumor necrosis factor alpha-converting enzyme)-dependent mechanism. HAT also activates the PAR-2 and assists in regulating the cellular functions of human bronchial epithelial cells (HBEC). Additionally, it induces the fibroblast proliferation in bronchial airways by mediating the PAR-2-dependent MEK-MAPK pathway.

Sequenza

Synthetic peptide located within the following region: RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Mari Miki et al.
The journal of medical investigation : JMI, 50(1-2), 95-107 (2003-03-13)
It has been shown that human airway trypsin-like protease (HAT) is localized in human bronchial epithelial cells (HBEC), and trypsin activates protease-activated receptor-2 (PAR-2). Activation of PAR-2 activates G-protein followed by an increase of intracellular free Ca2+, [Ca2+]in. This study
Manabu Chokki et al.
The FEBS journal, 272(24), 6387-6399 (2005-12-13)
Human airway trypsin-like protease (HAT), a serine protease found in the sputum of patients with chronic airway diseases, is an agonist of protease-activated receptor-2 (PAR-2). Previous results have shown that HAT enhances the release of amphiregulin (AR); further, it causes
Rie Matsushima et al.
American journal of physiology. Lung cellular and molecular physiology, 290(2), L385-L395 (2005-10-04)
Human airway trypsin-like protease (HAT) was isolated from airway secretions and localized to bronchial epithelial cells by immunohistochemistry. In the present study, we examined whether HAT could stimulate DNA synthesis and proliferation of primary human bronchial fibroblasts (HBF). HAT significantly

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.