AV45801

Anti-CBR1 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-CBR, Anti-Carbonyl reductase 1, Anti-hCBR1
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: 2

Proprietà

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 30 kDa
• species reactivity: rabbit, mouse, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001748
• UniProt accession no.: P16152
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CBR1(873)

Descrizione

Immunogen

Synthetic peptide directed towards the C terminal region of human CBR1

Biochem/physiol Actions

Carbonyl reductase 1 (CBR1) is a ubiquitous, cytosolic, short-chain dehydrogenase. This enzyme acts on a substantial number of biologically and pharmacologically active substrates, including a variety of endogenous and xenobiotic carbonyl compounds.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Classe di stoccaggio: 10 - Combustible liquids
• wgk: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable