AV42559

Anti-ANKRD2 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-ARPP, Anti-Ankyrin repeat domain 2 (stretch responsive muscle), Anti-MGC104314
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 49 kDa
• Reattività contro le specie: guinea pig, horse, mouse, rabbit, human, dog, bovine, rat
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_001123453
• N° accesso UniProt: Q3B778
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ANKRD2(26287)

Descrizione

Descrizione generale

Ankyrin repeat domain 2 (stretch responsive muscle) (Ankrd2), a MARP mechanosensing protein, is believed to be involved in skeletal muscle hypertrophy through the regulation of cell signaling and gene expression within muscle cells.

Specificità

Anti-ANKRD2 antibody reacts with canine, human, mouse, and rat ankyrin repeat domain 2 (stretch responsive muscle) proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human ANKRD2

Applicazioni

Anti-ANKRD2 polyclonal antibody is used to tag Ankyrin repeat domain 2 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role Ankrd2 in muscle cell development.

Azioni biochim/fisiol

ANKRD2 may play an important role in skeletal muscle hypertrophy.

Sequenza

Synthetic peptide located within the following region: QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable