AV40681

Anti-SURF6 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Surfeit 6
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 40 kDa
• Reattività contro le specie: human, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_006744
• N° accesso UniProt: O75683
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... SURF6(6838)

Descrizione

Descrizione generale

The gene SURF6 (surfeit 6) encodes a member of the Surfeit locus that is found to be localized to the nucleolus. The encoded protein is a unique component of the nucleolar matrix system with no sequence similarity with any other known protein.

Immunogeno

Synthetic peptide directed towards the middle region of human SURF6

Azioni biochim/fisiol

The gene SURF6 (surfeit 6) encodes a protein that has the ability to bind to nucleic-acids, with more affinity for RNA. It is found to be a structural protein that is present at all stages of the cell cycle in nucleolar substructures. It may be involved in the structure and functions of the nucleolar matrix by associating with nucleic acids. It may also be involved in rRNA (ribosomal RNA) processing.

Sequenza

Synthetic peptide located within the following region: EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable