AV40654

Anti-SARS (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Seryl-tRNA synthetase
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 57 kDa
• Reattività contro le specie: bovine, horse, mouse, guinea pig, rat, rabbit, human, dog
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_006504
• N° accesso UniProt: P49591
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... SARS(6301)

Descrizione

Descrizione generale

tRNAs are aminoacylated by the aminoacyl-tRNA synthetases. Due to redundancy of the genetic code, which allows for 64 mRNA codons, tRNA isoacceptors exist that may be aminoacylated with one amino acid but differ in their anticodons. Seryl-tRNA synthetase (SARS) is an enzyme that aminoacylates target tRNA with serine. Seryl-tRNA-synthetase interacts with the tRNA(Ser) acceptor stem, which makes this part of the tRNA a valuable structural element for investigating motifs of the protein-RNA complex. Cytosolic seryl-tRNA synthetase (hsSerRS) is responsible for the covalent attachment of serine to its cognate tRNA(Ser).

The previously assigned protein identifier Q5T5C8 has been merged into P49591. Full details can be found on the UniProt database.

Specificità

Anti-SARS (AB1) polyclonal antibody reacts with canine, zebrafish, chicken, human, mouse, rat, and bovine cytosolic seryl-tRNA synthetases.

Immunogeno

Synthetic peptide directed towards the C terminal region of human SARS

Applicazioni

Anti-SARS (AB1) polyclonal antibody is used to tag cytosolic seryl-tRNA synthetase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of cytosolic seryl-tRNA synthetase in tRNA serine acylation and translation

Azioni biochim/fisiol

SARS belongs to the class II amino-acyl tRNA family. The enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts.

Sequenza

Synthetic peptide located within the following region: PEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable