AV37341

Anti-YAF2 antibody produced in rabbit

affinity isolated antibody

• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 20 kDa
• Reattività contro le specie: human, mouse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_077151
• N° accesso UniProt: Q99LW6
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: mouse ... YAF2(67057)

Descrizione

Descrizione generale

YY1-associated factor 2 (YAF2) interacts with the zinc finger protein YY1 and promotes it′s proteolytic cleavage by m-calpain. YAF2 has Los been shown to bind to MYC and inhibits MYC-mediated transactivation.

Immunogeno

Synthetic peptide directed towards the middle region of mouse YAF2

Azioni biochim/fisiol

Yaf2 binds to MYC and inhibits MYC-mediated transactivation. Yaf2 also binds to MYCN and enhances MYCN-dependent transcriptional activation. Yaf2 increases calpain 2-mediated proteolysis of YY1 in vitro. Yaf2 is a component of the E2F6.com-1 complex, a repressive complex that methylates Lys-9 of histone H3, suggesting that it is involved in chromatin-remodeling.

Sequenza

Synthetic peptide located within the following region: GDLTVIITDFKEKAKSAPASSAAGDQHSQGSCSSDSTERGVSRSSSPRGE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable