Passa al contenuto
Merck
Tutte le immagini(3)

Documenti

AV35307

Sigma-Aldrich

Anti-MCOLN1 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Mucolipin 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

64 kDa

Reattività contro le specie

pig, rabbit, dog, human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... MCOLN1(57192)

Descrizione generale

MCOLN1 codes for a transmembrane protein that is found in vesicles. It is involved in endocytosis and lysosomal exocytosis. MCOLN1 mutations have been associated with the neurodegenerative lysosomal storage disorder, mucolipidosis type IV (MLIV).
Rabbit Anti-MCOLN1 antibody recognizes bovine, canine, human, rat, and mouse MCOLN1.

Immunogeno

Synthetic peptide directed towards the N terminal region of human MCOLN1

Applicazioni

Rabbit Anti-MCOLN1 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.

Azioni biochim/fisiol

MCOLN1 encodes a protein that may be involved in calcium signaling and membrane trafficking in mucolipidosis IV.

Sequenza

Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Gideon Bach et al.
Human mutation, 26(6), 591-591 (2005-11-16)
Mucolipidosis type IV (MLIV) is a neurodegenerative lysosomal storage disorder that occurs in an increased frequency in the Ashkenazi Jewish (AJ) population. The frequency of the disease in this population has been established by the testing of 66,749 AJ subjects
Yin Xu et al.
Molecular psychiatry, 26(10), 5925-5939 (2020-05-06)
Neurofibrillary tangles (NFTs) composed of hyperphosphorylated and misfolded tau protein are a pathological hallmark of Alzheimer's disease and other tauopathy conditions. Tau is predominantly an intraneuronal protein but is also secreted in physiological and pathological conditions. The extracellular tau has

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.