Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV35178

Sigma-Aldrich

Anti-KCNA10 antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Potassium voltage-gated channel, shaker-related subfamily, member 10

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

56 kDa

Reattività contro le specie

human, rat, mouse, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... KCNA10(3744)

Descrizione generale

KCNA10 codes for a tetrameric protein that belongs to the potassium channel, voltage-gated (shaker-related) family. It is strongly expressed in hair cells of the inner ear in mice. A null mutation in Kcna10 has been linked to vestibular and hearing dysfunctions in mice.
Rabbit Anti-KCNA10 antibody recognizes human, mouse, rat, and chicken KCNA10.

Immunogeno

Synthetic peptide directed towards the middle region of human KCNA10

Applicazioni

Rabbit Anti-KCNA10 antibody is suitable for western blot (1.25 μg/ml) and IHC (4-8 μg/ml) applications.

Azioni biochim/fisiol

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Four sequence-related potassium channel genes, shaker, shaw, shab, and shal, have been identified in Drosophila, and each has been shown to have human homolog(s). KCNA10 encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP.

Sequenza

Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Sue I Lee et al.
Hearing research, 300, 1-9 (2013-03-27)
KCNA10 is a voltage gated potassium channel that is expressed in the inner ear. The localization and function of KCNA10 was studied in a mutant mouse, B6-Kcna10(TM45), in which the single protein coding exon of Kcna10 was replaced with a
Francesca A Carlisle et al.
Gene expression patterns : GEP, 12(5-6), 172-179 (2012-03-27)
The development of the organ of Corti and the highly specialized cells required for hearing involves a multitude of genes, many of which remain unknown. Here we describe the expression pattern of three genes not previously studied in the inner

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.