Passa al contenuto
Merck
Tutte le immagini(1)

Documenti

AV34529

Sigma-Aldrich

Anti-SMARCAD1 (AB2) antibody produced in rabbit

affinity isolated antibody

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(1)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

39 kDa

Reattività contro le specie

horse, human, dog

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_001121901

N° accesso UniProt

Q9H4L7

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... SMARCAD1(56916)

Descrizione generale

SMARCAD1 is a SWI/SNF-related helicase that regulates heterochromatin organization and histone deacteylation. Studies in humans have reported that SMARCAD1 can enhance DNA end resection. SMARCAD1 mutation has been linked to autosomal-dominant adermatoglyphia.
Rabbit Anti-SMARCAD1 recognizes bovine, human, mouse, rat, and canine SMARCAD1.

Immunogeno

Synthetic peptide directed towards the N terminal region of human SMARCAD1

Applicazioni

Rabbit Anti-SMARCAD1 is suitable for western blot applications at a concentration of 1 μg/ml.

Azioni biochim/fisiol

SMARCAD1 belongs to the SNF2/RAD54 helicase family. It contains 2 CUE domains, 1 helicase ATP-binding domain, and 1 helicase C-terminal domain. It is a probable ATP-dependent DNA helicase.

Sequenza

Synthetic peptide located within the following region: RANTPDSDITEKTEDSSVPETPDNERKASISYFKNQRGIQYIDLSSDSED

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Thomas Costelloe et al.
Nature, 489(7417), 581-584 (2012-09-11)
Several homology-dependent pathways can repair potentially lethal DNA double-strand breaks (DSBs). The first step common to all homologous recombination reactions is the 5'-3' degradation of DSB ends that yields the 3' single-stranded DNA required for the loading of checkpoint and
Janna Nousbeck et al.
American journal of human genetics, 89(2), 302-307 (2011-08-09)
Monogenic disorders offer unique opportunities for researchers to shed light upon fundamental physiological processes in humans. We investigated a large family affected with autosomal-dominant adermatoglyphia (absence of fingerprints) also known as the "immigration delay disease." Using linkage and haplotype analyses

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.