AV32386
Anti-SIRT1 antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-Sirtuin (silent mating type information Regulation 2 homolog) 1 (S. cerevisiae)
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
82 kDa
Reattività contro le specie
rabbit, horse, guinea pig, rat, human, bovine, dog, mouse
Concentrazione
0.5 mg - 1 mg/mL
tecniche
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... SIRT1(23411)
Descrizione generale
Rabbit polyclonal anti-SIRT1 antibody reacts with chicken, human, mouse, rat, canine, and pig sirtuin-1 enzymes.
Sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) (SIRT1), a member of the NAD(+)-dependent protein deacetylase SIRT family, is involved in the regulation of nuclear transcription of genes involve in energy metabolism. SIRT1 provides a link between cellular energy status sensing (NAD(+) status) and the regulation of energy homoeostasis. SIRT1 is involved in the regulation of metabolism, cell differentiation and senescence, stress response, and cancer.
Immunogeno
Synthetic peptide directed towards the N terminal region of human SIRT1
Applicazioni
Rabbit Anti-SIRT1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Rabbit polyclonal anti-SIRT1 antibody is used to tag sirtuin-1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of sirtuin-1 in NAD(+) status-dependent energy homeostasis at the level of nuclear transcription control and protein deacetylation.
Azioni biochim/fisiol
SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined;
Sequenza
Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Éverton Lopes Vogt et al.
International journal of environmental research and public health, 18(14) (2021-07-25)
Introduction and objectives: Obesity represents a major global public health problem. Its etiology is multifactorial and includes poor dietary habits, such as hypercaloric and hyperlipidic diets (HFDs), physical inactivity, and genetic factors. Regular exercise is, per se, a tool for
Knut H Lauritzen et al.
Neurobiology of aging, 48, 34-47 (2016-09-18)
Mitochondrial genome maintenance plays a central role in preserving brain health. We previously demonstrated accumulation of mitochondrial DNA damage and severe neurodegeneration in transgenic mice inducibly expressing a mutated mitochondrial DNA repair enzyme (mutUNG1) selectively in forebrain neurons. Here, we
Yan Li et al.
International journal of molecular medicine, 41(6), 3517-3526 (2018-03-14)
Mitochondrial dynamics have critical roles in aging, and their impairment represents a prominent risk factor for myocardial dysfunction. Mitochondrial deacetylase sirtuin (SIRT)3 contributes greatly to the prevention of redox stress and cell aging. The present study explored the role of SIRT3
Moez Eid et al.
Frontiers in physiology, 13, 782684-782684 (2022-05-17)
Sirtuins (SIRTs) are NAD+- dependent histone deacetylases. They are involved in a variety of biological pathways and are thought to be a promising target for treating several human disorders. Although evidence is piling up to support the neuroprotective role of
Svetlana Demyanenko et al.
Journal of stroke and cerebrovascular diseases : the official journal of National Stroke Association, 29(10), 105152-105152 (2020-09-12)
Sirtuins, class III histone deacetylases, are involved in the regulation of tissue repair processes and brain functions after a stroke. The ability of some isoforms of sirtuins to circulate between the nucleus and cytoplasm may have various pathophysiological effects on
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.