AV31957

Anti-HOXC4 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Homeobox C4
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 29 kDa
• Reattività contro le specie: rabbit, bovine, dog, human, guinea pig, horse, mouse, rat
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_055435
• N° accesso UniProt: P09017
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... HOXC4(3221)

Descrizione

Descrizione generale

HOXC4 is a homeobox transcription factor that is involved in the differentiation of lymphoid cells and keratinocytes.
Rabbit Anti-HOXC4 recognizes human, mouse, rat, canine, zebrafish, and bovine HOXC4.

Immunogeno

Synthetic peptide directed towards the N terminal region of human HOXC4

Applicazioni

Rabbit Anti-HOXC4 can be used for western blot applications at a concentration of 2μg/ml.

Azioni biochim/fisiol

HOXC4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, are co-transcribed in a primary transcript. Subsequent processing results in gene-specific transcripts, which sometimes share a 5′ non-coding exon.

Sequenza

Synthetic peptide located within the following region: MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable