AV30060

Anti-ZNF512 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-Zinc finger protein 512
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 65 kDa
• Reattività contro le specie: bovine, guinea pig, human, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_115810
• N° accesso UniProt: Q96ME7
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... ZNF512(84450)

Descrizione

Descrizione generale

ZNF512 is a protein that may have four zinc finger motifs that probably interact with nucleic acid or proteins. Rabbit Anti-ZNF512 antibody binds to bovine, human, mouse, and rat ZNF512.

Immunogeno

Synthetic peptide directed towards the middle region of human ZNF512

Applicazioni

Rabbit Anti-ZNF512 antibody can be used for western blot (0.5μg/ml) applications.

Azioni biochim/fisiol

ZNF512 is a new candidate transcription factor.

Sequenza

Synthetic peptide located within the following region: QLRSLAGMKYHVMANHNSLPILKAGDEIDEPSERERLRTVLKRLGKLRCM

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable